¿Qué situaciones se benefician del estudio de Perl?

Question

estoy jugando un poco con study, una característica Perl para examinar una cadena para hacer expresiones regulares posteriores potencialmente mucho más rápida:

while(<>) { 
    study; 
    $count++ if /PATTERN/; 
    $count++ if /OTHER/; 
    $count++ if /PATTERN2/; 
    } 

no hay mucho decir de qué situaciones se beneficiarán de esta. Algunas cosas que usted puede hacer surgir de the docs:

• patrones con cadenas constantes
• Múltiples patrones
• cadenas más cortas de destino podría ser mejor (toma menos tiempo para estudiar)

estoy Buscando casos concretos en los que no solo puedo demostrar una gran ventaja, sino también casos que puedo modificar ligeramente para perder esa ventaja. Una de las advertencias en the docs es que debe comparar casos individuales. Quiero encontrar algunos de los casos de borde donde una pequeña diferencia en una cuerda (o patrón) hace una gran diferencia en el rendimiento.

Si no ha usado study, no responda. Prefiero tener respuestas correctas bien formadas en lugar de conjeturas rápidas. No hay urgencia aquí, y esto no demora ningún trabajo.

Y, como beneficio adicional, he estado jugando con una herramienta de evaluación comparativa que compara dos carreras de NYTProf, que prefiero usar que la herramienta habitual de evaluación comparativa. Si se me ocurre una forma de automatizar eso, lo compartiré también.

Answer 1

Google volvió a esta lovely test scenario:

#!/usr/bin/perl 
# 
# Exercise 7.8 
# 
# This is a more difficult exercise. The study function in Perl may speed up searches 
# for motifs in DNA or protein. Read the Perl documentation on this function. Its use 
# is simple: given some sequence data in a variable $sequence, type: 
# 
# study $sequence; 
# 
# before doing the searches. Do you think study will speed up searches in DNA or 
# protein, based on what you've read about it in the documentation? 
# 
# For lots of extra credit! Now read the Perl documentation on the standard module 
# Benchmark. (Type perldoc Benchmark, or visit the Perl home page at http://www. 
# perl.com.) See if your guess is right by writing a program that benchmarks motif 
# searches of DNA and of protein, with and without study. 
# 
# Answer to Exercise 7.8 

use strict; 
use warnings; 

use Benchmark; 

my $dna = join ('', qw(
agatggcggcgctgaggggtcttgggggctctaggccggccacctactgg 
tttgcagcggagacgacgcatggggcctgcgcaataggagtacgctgcct 
gggaggcgtgactagaagcggaagtagttgtgggcgcctttgcaaccgcc 
tgggacgccgccgagtggtctgtgcaggttcgcgggtcgctggcgggggt 
cgtgagggagtgcgccgggagcggagatatggagggagatggttcagacc 
cagagcctccagatgccggggaggacagcaagtccgagaatggggagaat 
gcgcccatctactgcatctgccgcaaaccggacatcaactgcttcatgat 
cgggtgtgacaactgcaatgagtggttccatggggactgcatccggatca 
ctgagaagatggccaaggccatccgggagtggtactgtcgggagtgcaga 
gagaaagaccccaagctagagattcgctatcggcacaagaagtcacggga 
gcgggatggcaatgagcgggacagcagtgagccccgggatgagggtggag 
ggcgcaagaggcctgtccctgatccagacctgcagcgccgggcagggtca 
gggacaggggttggggccatgcttgctcggggctctgcttcgccccacaa 
atcctctccgcagcccttggtggccacacccagccagcatcaccagcagc 
agcagcagcagatcaaacggtcagcccgcatgtgtggtgagtgtgaggca 
tgtcggcgcactgaggactgtggtcactgtgatttctgtcgggacatgaa 
gaagttcgggggccccaacaagatccggcagaagtgccggctgcgccagt 
gccagctgcgggcccgggaatcgtacaagtacttcccttcctcgctctca 
ccagtgacgccctcagagtccctgccaaggccccgccggccactgcccac 
ccaacagcagccacagccatcacagaagttagggcgcatccgtgaagatg 
agggggcagtggcgtcatcaacagtcaaggagcctcctgaggctacagcc 
acacctgagccactctcagatgaggaccta 
)); 

my $protein = join('', qw(
MNIDDKLEGLFLKCGGIDEMQSSRTMVVMGGVSGQSTVSGELQD 
SVLQDRSMPHQEILAADEVLQESEMRQQDMISHDELMVHEETVKNDEEQMETHERLPQ 
GLQYALNVPISVKQEITFTDVSEQLMRDKKQIR 
)); 

my $count = 1000; 

print "DNA pattern matches without 'study' function:\n"; 
timethis($count, 
    ' for(my $i=1 ; $i < 10000; ++$i) { 
     $dna =~ /aggtc/; 
     $dna =~ /aatggccgt/; 
     $dna =~ /gatcgatcagctagcat/; 
     $dna =~ /gtatgaac/; 
     $dna =~ /[ac][cg][gt][ta]/; 
     $dna =~ /ccccccccc/; 
    } ' 
); 

print "\nDNA pattern matches with 'study' function:\n"; 
timethis($count, 
    ' study $dna; 
    for(my $i=1 ; $i < 10000; ++$i) { 
     $dna =~ /aggtc/; 
     $dna =~ /aatggccgt/; 
     $dna =~ /gatcgatcagctagcat/; 
     $dna =~ /gtatgaac/; 
     $dna =~ /[ac][cg][gt][ta]/; 
     $dna =~ /ccccccccc/; 
    } ' 
); 

print "\nProtein pattern matches without 'study' function:\n"; 
timethis($count, 
    ' for(my $i=1 ; $i < 10000; ++$i) { 
     $protein =~ /PH.EI/; 
     $protein =~ /KFTEQGESMRLY/; 
     $protein =~ /[YAL][NVP][ISV][KQE]/; 
     $protein =~ /DKKQIR/; 
     $protein =~ /[MD][VT][HQ][ER]/; 
     $protein =~ /NVPISVKQEITFTDVSEQL/; 
    } ' 
); 

print "\nProtein pattern matches with 'study' function:\n"; 
timethis($count, 
    ' study $protein; 
    for(my $i=1 ; $i < 10000; ++$i) { 
     $protein =~ /PH.EI/; 
     $protein =~ /KFTEQGESMRLY/; 
     $protein =~ /[YAL][NVP][ISV][KQE]/; 
     $protein =~ /DKKQIR/; 
     $protein =~ /[MD][VT][HQ][ER]/; 
     $protein =~ /NVPISVKQEITFTDVSEQL/; 
    } ' 
); 

Tenga en cuenta que la ganancia reportada es solamente alrededor de ~ 2% para el caso más rentable (proteína coincide):

# $ perl exer07.08 
# On my computer, this is the output I get: your results probably vary. 

# DNA pattern matches without 'study' function: 
# timethis 1000: 29 wallclock secs (29.25 usr + 0.00 sys = 29.25 CPU) @ 34.19/s (n=1000) 
# 
# DNA pattern matches with 'study' function: 
# timethis 1000: 30 wallclock secs (29.21 usr + 0.15 sys = 29.36 CPU) @ 34.06/s (n=1000) 
# 
# Protein pattern matches without 'study' function: 
# timethis 1000: 32 wallclock secs (29.47 usr + 0.04 sys = 29.51 CPU) @ 33.89/s (n=1000) 
# 
# Protein pattern matches with 'study' function: 
# timethis 1000: 30 wallclock secs (28.97 usr + 0.02 sys = 28.99 CPU) @ 34.49/s (n=1000) 
# 

Answer 2

voy a deje notas como respuesta, y luego lo desarrollaré en una respuesta real:

En pp.cPP(pp_study) , Tiene estas líneas curiosas (menos un comentario):

if (len == 0 || len > I32_MAX || !SvPOK(sv) || SvUTF8(sv) || SvVALID(sv)) { 
RETPUSHNO; 
} 

Parece escalares con el flag UTF8 no se estudian en absoluto.

Answer 3

No realmente. Si busca, y la mayoría de los resultados están en el conjunto de pruebas de Perl, eso significa que nadie lo usa. Además, debido a error, solo puedes notice speed benefits on global variables. En realidad, trajo algunas mejoras de velocidad cuando se trataba de inglés (a veces incluso 2 veces más rápido), pero se tenía que hacer una variable global.

También a veces causaba infinite loops o false positives (study podría añadir insectos a su programa, incluso cuando estaba solo supone para hacerlo más rápido), y debido a que era removed (or rather, made no-op) in Perl 5.16 – nadie quería mantener una parte nadie se preocupa de todos modos .